clintonboitumelo111 clintonboitumelo111

09-05-2024
Mathematics

Answered

2.1.5 Mr Mpyapedi and family plan to leave home as early as 03h30 in the Smorning. They will make 4 stops (15 minutes each) for refuelling and read Fe refreshing. Determine the time that they will reach Cape Town if he is consistently driving at an average speed of 120km/hr. Express your answer in hours and minutes. You may use the formula: Distance in km Average speed= (7) Time in hrs

Answer :

Other Questions

Match the definition with the vocabulary word.1. a thought or idea that is not a tangible (touchable) thing2.something that is tangible (touchable) or perceived

La respuesta usando la forma quadratica

Is Using a 5 m long ladder to prune a tree.1. Figure out how high the ladder would reach on the tree in each case.a) The base of the ladder is fairly close to t

The first few amino acids of the protein hemoglobin are given below: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALT How many alpha helices

PromptWrite an argumentative essay for or against the idea of using controlled fires to protect wild areas.<< Read LessOutlineKWHLXBIUS X Styles NormalFon

Read the statement below to answer this question.Cenderleg's Chorolate Factory aims to improve the livelihoods of women in its cocoa supply chain in Cote d'lvoi

What are some of the factors that can influence IoT data quality, and how can organizations ensure strong data governance to maintain data quality throughout th

14) Classes 8A, 8B and 8C are going on a skiing trip. The maximum allowed ratio of students to skiing instructors is 9 : 1. Classes with fewer than 7 students c

Create your thesis for your writing assignment. List three main ideas that support your thesis. Then, consider what evidence you could use tovsupport each main

I need quotes, explanations, and what is revealed?